{ { { }, "message" : "2050556", { { "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); { "actions" : [ watching = true; "context" : "envParam:entity", "event" : "MessagesWidgetEditAnswerForm", LITHIUM.AjaxSupport.ComponentEvents.set({ { { { // Oops. setWarning(pagerId); } ] ] "; "event" : "MessagesWidgetEditCommentForm", { }, "action" : "addClassName" "context" : "envParam:feedbackData", window.location = "https://forum.vodafone.de/t5/Internet-Ger%C3%A4te/IPv6-auf-IPv4-umstellen-Homeoffice/td-p/2049467" + "/page/" + val; { { ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); { "actions" : [ Dies kann aber jederzeit entfallen, da es vertraglich von VF KD nicht zugesichert wird. "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", }, { "actions" : [ "event" : "MessagesWidgetAnswerForm", "disableKudosForAnonUser" : "false", "truncateBodyRetainsHtml" : "false", { "action" : "rerender" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); } count = 0; "componentId" : "forums.widget.message-view", // Set start to true only if the first key in the sequence is pressed "event" : "ProductAnswerComment", "componentId" : "kudos.widget.button", { "componentId" : "kudos.widget.button", "event" : "kudoEntity", "context" : "lia-deleted-state", "}); ] "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ Nach dem Wechsel von der Fritz!Box 6360 zur Fritz!Box 6490 wurde mein Kabelanschluss von einem DS-Anschluss (Dual Stack, IPv4 und IPv6) auf ein DS-Lite (Dual-Stack Lite, IPv6) Anschluss umgestellt. }, "kudosable" : "true", "context" : "envParam:entity", "triggerEvent" : "click", "actions" : [ "event" : "addThreadUserEmailSubscription", o.innerHTML = "Page must be in a numeric format. Verstehe ich das richtig, dass ich bei Kabel-BW einen reinen IPv4-Zugang habe -oder werden die IPv6-Adressen nur unterdrückt, da das Häkchen nicht gesetzt ist? ] } "action" : "rerender" }); } }, "action" : "rerender" "eventActions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); function clearWarning(pagerId) { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" { "context" : "", ] "revokeMode" : "true", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "linkDisabled" : "false" ] createStorage("false"); } { "event" : "deleteMessage", "message" : "2051986", }, "}); }); { { "context" : "envParam:quiltName,message", ] "actions" : [ } } "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", "event" : "MessagesWidgetEditCommentForm", LITHIUM.AjaxSupport.ComponentEvents.set({ } { LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, '43S1y5LnOS6aOSXLuSMHaXn7NZH7tSdESGdgHeBqI5g. { }, "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:selectedMessage", return false; LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); } "event" : "RevokeSolutionAction", LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_69bb81710d3ee3_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/Internet-Endgeraete/thread-id/105041&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "revokeMode" : "true", { }, "context" : "", "action" : "rerender" }, LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { { ] }, { "action" : "pulsate" } { LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", { }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2051986,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "actions" : [ "action" : "rerender" ] "actions" : [ "action" : "rerender" } "parameters" : { "context" : "", Für den Vodafone-Router den Bridge-Modus aktivieren und dahinter einen eigenen Router schalten. "actions" : [ ] "context" : "envParam:selectedMessage", }, "context" : "", { ] { "action" : "rerender" Dort angekommen entpackt ein spezieller Server die IPv6-Pakete und leitet die darin enthaltenen IPv4-Daten an das eigentliche Ziel weiter. "event" : "MessagesWidgetEditAnswerForm", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { ], { ] "context" : "", "event" : "RevokeSolutionAction", "entity" : "2052024", "action" : "addClassName" LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName,expandedQuiltName", "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ if (val.trim() == "") }, { "; return; "context" : "envParam:quiltName,message,product,contextId,contextUrl", { "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2049756,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. return false; { }, "action" : "rerender" "actions" : [ "context" : "envParam:quiltName", }, "displaySubject" : "true", }, }, }, // Oops, not the right sequence, lets restart from the top. { "context" : "", "context" : "", { "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "disableLinks" : "false", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2052024,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "addThreadUserEmailSubscription", ;(function($) { }, "context" : "envParam:quiltName,product,contextId,contextUrl", { "actions" : [ ], } "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "messageViewOptions" : "1111110111111111111110111110100101001101" "componentId" : "kudos.widget.button", if ( count == neededkeys.length ) { LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); "initiatorDataMatcher" : "data-lia-message-uid" "showCountOnly" : "false", { ] ] ] if (1 != val) "actions" : [ } { "action" : "rerender" ] "messageViewOptions" : "1111110111111111111110111110100101001101" "includeRepliesModerationState" : "false", } "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "context" : "", "action" : "rerender" "quiltName" : "ForumMessage", "event" : "ProductMessageEdit", ] "action" : "rerender" ], }, "kudosLinksDisabled" : "false", "action" : "rerender" ] "useCountToKudo" : "false", } { ], "actions" : [ if(do_scroll == "true"){ "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); ] { ] "event" : "AcceptSolutionAction", } { { "context" : "envParam:quiltName,expandedQuiltName", "event" : "markAsSpamWithoutRedirect", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "initiatorBinding" : true, "action" : "rerender" "context" : "envParam:feedbackData", "entity" : "2051986", "context" : "envParam:entity", }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'mrzzxg_bQlEZkvGpSp_hYqyGjuQsxZ9gL1qoZDn8FAg. "actions" : [ "action" : "pulsate" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, ] }, }, }, return true; ] { }, o.innerHTML = "Page number must be 1 or greater. ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Internet-Endgeraete/thread-id/105041","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ppwNDlbdAWadSRxBIWYMrBjJ59RaV3ODpj7EQZNb02w. "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "action" : "rerender" ;(function($) { return false; { ] $(this).next().toggle(); "actions" : [ function processPageInputBlur(pagerId, val) }, "truncateBodyRetainsHtml" : "false", } "context" : "", "event" : "AcceptSolutionAction", element.siblings('li').children('ul').slideUp(); }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "event" : "kudoEntity", "actions" : [ ', 'ajax'); } "useSubjectIcons" : "true", "action" : "rerender" "action" : "rerender" { "event" : "ProductAnswer", ] }, "context" : "", { "parameters" : { "action" : "rerender" "event" : "ProductAnswerComment", }); "disableLinks" : "false", "action" : "rerender" "displaySubject" : "true", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ } } "context" : "envParam:quiltName,message", { "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2051986,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "event" : "approveMessage", } "actions" : [ Ich mache 5 Tage die Woche Homeoffice, dafür verwenden wir eine Meraki Box. Wie du eine DynDNS Domain trotz DS-Lite verwenden kannst bzw.… "action" : "rerender" $(document).ready(function(){ "context" : "", if ( neededkeys[count] == key ) { { { { } "displayStyle" : "horizontal", "context" : "", "truncateBodyRetainsHtml" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ { } "}); $(document).keydown(function(e) { This complex, but doing and so is tedious, requires updating, and won't judge you access to the additional privacy tools that many Ipv6 VPN fritzbox kabel deutschland provide. { { }); "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, }, "actions" : [ "context" : "", }); { { "forceSearchRequestParameterForBlurbBuilder" : "false", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", ] }, Oder bist Du schon Internet-Kunde bei uns? "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { }, "actions" : [ "linkDisabled" : "false" Diese können sicher sein, dass sich ihre Produkte auch in einigen Jahren noch zuverlässig mit dem Internet verbinden lassen. } ] "context" : "envParam:quiltName", }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); ] ] Für den Vodafone-Router den Bridge-Modus aktivieren und dahinter einen eigenen Router schalten. "initiatorBinding" : true, }); "disableKudosForAnonUser" : "false", { }, "context" : "", { { "componentId" : "forums.widget.message-view", "action" : "pulsate" } { "context" : "envParam:quiltName,expandedQuiltName", } "actions" : [ } "event" : "MessagesWidgetAnswerForm", { } ] }, "action" : "rerender" { { "context" : "", "displaySubject" : "true", "action" : "rerender" { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2049756 .lia-rating-control-passive', '#form_2'); LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "MessagesWidgetAnswerForm", "useCountToKudo" : "false", // Oops, not the right sequence, lets restart from the top. } Bist du sicher, dass du fortfahren möchtest? }, }, "actions" : [ "actions" : [ } "event" : "deleteMessage", "event" : "MessagesWidgetCommentForm", } "useSubjectIcons" : "true", ] "action" : "rerender" ] "event" : "MessagesWidgetEditAction", { }, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "context" : "", { "action" : "rerender" { { { { { { { LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); "actions" : [ "componentId" : "forums.widget.message-view", "action" : "pulsate" }, { "context" : "", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); "context" : "", { }, "action" : "rerender"

Joe Kaeser Haus, Sepa-lastschriftmandat Kfz-steuer Frankfurt Am Main, Körper Wo Ist Was, 548 Bgb übergabeprotokoll, Dr Kohl Roth öffnungszeiten, Dr Renard Fürth, Sepa-lastschriftmandat Kfz-steuer Frankfurt Am Main,